Peptide A5K (INF7-A5K-TAT) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold.
Peptide A5K
Peptide A5K (INF7-A5K-TAT) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold. Peptide A5K can non-covalently bind to CRISPR ribonucleoproteins and efficiently deliver them to cells, such as primary human T cells, B cells, and NK cells. Peptide A5K enables low-toxicity, precise, and multiplex genome editing, holding great application potential in the field of cell therapy.
|
|
|
|
| Cat No. | Size | Price (USD) | Delivery time |
|
| GEB700011-10 | 10 mg | Inquiry | 2~3 weeks |
|
| GEB700011-20 | 20 mg | Inquiry | 2~3 weeks |
|
| GEB700011-50 | 50 mg | Inquiry | 2~3 weeks |
|
| Purity: | >95% or >98% |
| Sequence: | GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR |
|
| Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg |
| CAS No.: | / |
| Formula: | C182H275N55O48S |
| Molecular Weight: | 4033.54 |
| Appearance: | Lyophilized white powder |
| Counter Ion: | TFA |
| Storage: | Power: -20°C(1 year) or -80°C(2 years) |
| Shipping: | All peptides will be shipped as lyophilized powder with desiccant at room temperature. |
