GenicBio
-Focus on providing premier services

Tel: +86-021-3762 1270

Fax: +86-021-6762 1877

Email: service@genicbio.com

 Beta-Amyloid 1-40, HFIP
 3XFlag peptide
 MOG 35-55
 Beta-Amyloid 1-42, HFIP
 Beta-Amyloid 1-42, TFA
 Beta-Amyloid 1-40, TFA
Beta-Amyloid 1-40, HCl

Beta-Amyloid 1-40, HCl



 
    Cat No. Size Price (USD) Delivery time
    A-40-H-1 1 mg    $175.00     3~5 days
    A-40-H-5 5 mg    $550.00     3~5 days
    A-40-H-10 10 mg    $900.00     3~5 days

  Purity: >95%
  Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile- Gly-Leu-Met-Val-Gly-Gly-Val-Val
  CAS No.: 131438-79-4
  Formula: C194H295N530O58S1
  Molecular Weight: 4329.90
  Appearance: Lyophilized white powder
  Counter Ion: HCl
  Storage: Power: -20°C(1 year)  or -80°C(1~2 years)
  Reconstitution: Water
  Shipping: All peptides will be shipped as lyophilized powder with desiccant at room temperature.

Selected Publications using GenicBio's Beta amyloid peptides:


............................................................