GenicBio
-Focus on providing premier services

Tel: +86-021-3762 1270

Fax: +86-021-6762 1877

Email: service@genicbio.com

 Beta-Amyloid 1-40, HFIP
 3XFlag peptide
 MOG 35-55
 Beta-Amyloid 1-42, HFIP
 Beta-Amyloid 1-42, TFA
 Beta-Amyloid 1-40, TFA
Beta-Amyloid 1-42, Scrambled

Beta-Amyloid 1-42, Scrambled


 
    Cat No. Size Price (USD) Delivery time
    A-42-S-1 1 mg    $200.00    3~5 days
    A-42-S-5 5 mg    $650.00    3~5 days
    A-42-S-10 10 mg   $1,000.00    3~5 days

  Purity: >95%
  Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
    Ala-Ile-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala
  CAS No.: /
  Formula: C203H311N55O60S
  Molecular Weight: 4514.14
  Appearance: Lyophilized yellow power
  Counter Ion: TFA
  Storage: Power: -20°C(1 year)  or -80°C(1~2 years)
  Reconstitution: Acetic acid/water (3:2) or DMSO
  Shipping: All peptides will be shipped as lyophilized powder with desiccant at room temperature.